Basic Information | |
---|---|
Taxon OID | 3300017479 Open in IMG/M |
Scaffold ID | Ga0186655_1024669 Open in IMG/M |
Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from South Pacific Ocean in L1 medium, 22 C, 20 psu salinity and 668 ?mol photons light - Karlodinium veneficum CCMP 2283 (MMETSP1015) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1091 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Pacific Ocean | |||||||
Coordinates | Lat. (o) | -32.2167 | Long. (o) | -80.7355 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056239 | Metatranscriptome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186655_10246691 | F056239 | N/A | LKIVTAVTSLLPRPFAMSATISAAGSVALKNTRGAHPTVRLDGFLRSTDQGYQHGEAQTQGDRFVRKMATYGQVRPSVMFTSESRAQRAPTGIDSSNLPATWADPRGEPKELTFEYPPPPTEINEEHFKLIKNHSLMLPSERFREHCIMREGEKNWKQNRKDAFMYKKRMQKIEREYQNGIIGVDGPMFPGTKLYEQQRGYLEAMSEYKGVKAEGRFHNLAHQNRADDASAFRNFGMPHDLPRSHDVGMQRKCVHPEKHPHRFLDTHDRLFPTYVPVWDPERAATLRSHDVRGKKHNILNQSDNYMEHRVAPNWEEQAQKQLEMRIAAQAPRREPEMV |
⦗Top⦘ |