Scaffold Ga0186481_1043899

Overview

Basic Information

• Taxon OID: 3300017382
• Scaffold ID: Ga0186481_1043899
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Baltic Sea in f/2 medium with sea water w/o silica, 3 C, 3 psu salinity and 693 ?mol photons light - Scrippsiella Hangoei SHTV-5 (MMETSP0360)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 59.51
  • Long. (^o): 23.13
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078185	Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186481_10438991	F078185	GGAG	MGGHTRLWHPKFFTRYIWGAIATIQVTGFVADQQYGIDRKKNPEFMWPWWHEIMRKKENGEIPMDMPGYMLCKYRNEPEERWTAEREQEYGEFMGAMDAE