| Basic Information | |
|---|---|
| Taxon OID | 3300017376 Open in IMG/M |
| Scaffold ID | Ga0186625_1045320 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine algae-associated eukaryotic communities from Gulf of Mexico in f/2 medium with seawater, 25 C, 36 psu salinity and 270 ?mol photons light - Karenia brevis Wilson (MMETSP0201) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 739 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063312 | Metatranscriptome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186625_10453201 | F063312 | AGGA | MPEYKLATNANNKATELPLCRIQGSVQPNPHMRAFWASTISFFLAFLGWFALAPLALDVAKSMEICENQLFPPETNPKRKAYLKFKNLKTEKFYCRYGKNDKDKPTDCKPPPAEIEAKDKCTASLTTNCATEDDLNPYDPTVLTKCVCTGGTECKSVLANAGVASVGSTIFVRVALGTLLERFGPVNVQSSLLLFGAIWVFAAAGISAPWNY |
| ⦗Top⦘ |