Scaffold Ga0186622_1030458

Overview

Basic Information

• Taxon OID: 3300017370
• Scaffold ID: Ga0186622_1030458
• Source Dataset Name: Metatranscriptome of marine algae-associated eukaryotic communities from Gulf of Mexico in L1 medium with seawater, 25 C, 27 psu salinity and 750 ?mol photons light - Karenia brevis Wilson (MMETSP0649_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1042
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034591	Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186622_10304582	F034591	N/A	LALKVAFDLPSSVHALVAMLQGVLVACLALASVAQDLFLAPVVADKPATSLPKSANRCPPKEWILQMYSGGHWILDYTDSSWDAYMQFLGLAESAWPIERNTSDIHEYYISKDGSYFVMNHTIPASKFHLLFKAELGTSSEPPAWSRTPYMMPTPAGFNPHPLKYNMTLWRNFIEEPGKPFPESCYALRTQNRGIYNNSGVLSELVVDFTGELLSPYEWRYSLHVWDWKTGKTIEPWKSQLQNAKPHPGVCYRYFKKAVQSFADAEARHPCQGMLVDGQTYQFC