Scaffold Ga0186696_1056385

Overview

Basic Information

• Taxon OID: 3300017367
• Scaffold ID: Ga0186696_1056385
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from Gulf of Mexico in L1 medium, 22 C, 32 psu salinity and 300 ?mol photons light - Karenia brevis CCMP 2229 (MMETSP0027)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 556
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.0171
  • Long. (^o): -82.4763

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082720	Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186696_10563851	F082720	N/A	EGRLSVVSESQVHIDGVQRYLVQFSSGELSRADGVGFVFSPXXXXPRLPCAKNIQRIVSIFVNQRGRICMRVFADIVRASAFVKPLECGDWVEMCIDLDNRMATFNVWPNTSNGWPPVTGTPSSTAEFPFGNKLTKLNQAGAKPVKLNVGHLACVVKNTGVTVTLGS