Scaffold Ga0186251_1000609

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186251_1000609

Scaffold Ga0186251_1000609

Overview

Basic Information
Taxon OID	3300017365 Open in IMG/M
Scaffold ID	Ga0186251_1000609 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic communities from Ross Sea in marine media K with soil extract, 1 C, 36 psu salinity and 367 ?mol photons light - Geminigera sp. Caron Lab Isolate (MMETSP1102)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3911
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name	Ross Sea
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034475	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186251_10006094	F034475	GAG	VVPGDRNWHIETADWNLAGFFTIFRNLLAGIWGSFLRFIETGFRNWLAAFLGFFYDFSM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.