Scaffold Ga0186694_1044627

Overview

Basic Information

• Taxon OID: 3300017361
• Scaffold ID: Ga0186694_1044627
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from Gulf of Mexico in L1 medium, 22 C, 32 psu salinity and 312 ?mol photons light - Scrippsiella trochoidea CCMP 3099 (MMETSP0272)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 741
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.3122
  • Long. (^o): -82.601

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051939	Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186694_10446271	F051939	GGAG	MGIAGSIADSPFLSYLQNEFERVAKNRVGALYLHQIQQLQPPQDCVLDLRHLATLWKLDKDRNGYVTFDELLDFAEFVNERRRLLGSLDFDRKLRAQCVVDLWEVIREDRGEEAFADWVIRIIAQGENHQTFAASPNVNFMSRDAVMTLYELLQPFQISSHIDQQGFLDMLQQIGEHMNLMSLHVEELDDWVPVMVVHRWARQFVRAYS