Scaffold Ga0186026_1010652

Overview

Basic Information

• Taxon OID: 3300017359
• Scaffold ID: Ga0186026_1010652
• Source Dataset Name: Metatranscriptome of marine sediment eukaryotic communities from Tyrrhenian Sea in L1 medium with seawater, 20 C, 33 psu salinity and 588 ?mol photons light - Alexandrium andersonii CCMP 2222 (MMETSP1436)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 801
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Tyrrhenian Sea
• Coordinates
  • Lat. (^o): 40.75
  • Long. (^o): 14.25
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009535	Metagenome / Metatranscriptome	316	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186026_10106521	F009535	N/A	MARRSGSALLSVLAVLALGCLSFHSSFVGTPPTARGRELVRRNVGVDYLLRNGPKDADPPLINPAAAAGAMHEVTFKKRPFGIARYAPGQAGTGAVVMEVTQQSRYPGDPQGQAFVAGVQPGWVVKSVNGDDVTSVKFEDIMEVLDDEVLDPVAALSLNLKESGTPTDFTDRSKGADTSYGPVGQGTFTFGGGKKAELPITIQYVEQR