| Basic Information | |
|---|---|
| Taxon OID | 3300017359 Open in IMG/M |
| Scaffold ID | Ga0186026_1007172 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine sediment eukaryotic communities from Tyrrhenian Sea in L1 medium with seawater, 20 C, 33 psu salinity and 588 ?mol photons light - Alexandrium andersonii CCMP 2222 (MMETSP1436) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 963 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tyrrhenian Sea | |||||||
| Coordinates | Lat. (o) | 40.75 | Long. (o) | 14.25 | Alt. (m) | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016530 | Metatranscriptome | 246 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186026_10071721 | F016530 | N/A | MAVSVPDSLLSSGTPEGVSATVSLPEDAWDMLGLGVSDAMNEKQMQVLNGQVALMTSAEYVAASKSSELETKEAYKQQWQYEAEQRLARIEAKKSPLERAGEGGMMKSQKFAWSKDGQKSFEWRKIYHALVGGVGGMPEGGLFTETVISPTAMRMYTDHRVMGAVVLPGVSHVSLMAATGSIGFPSPGGLANDWHMSIKETLFERPYIVNSGAELIAAISAGMDPSQVGGGGGGMQAAMLPVGVPMTYCRATGVGKERGXXXXXXXXXRLDEVSSGPRQQCMGLPPTQALQV |
| ⦗Top⦘ |