Scaffold Ga0186624_1039933

Overview

Basic Information

• Taxon OID: 3300017358
• Scaffold ID: Ga0186624_1039933
• Source Dataset Name: Metatranscriptome of marine algae-associated eukaryotic communities from Gulf of Mexico in L1 medium with seawater, 25 C, 27 psu salinity and 552 ?mol photons light - Karenia brevis SP3 (MMETSP0528_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 741
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091291	Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186624_10399331	F091291	N/A	FHGGFIDIVAINILPHLGGSPLRGWEPNKDPEKNPMQRRFMAENLAYALLRLAPVFFIKDMNVYMLTTISYLLEGGSISWEINFYNGTSDAMPPATLMCIFSTWVLLTVFFNQDDFIPDVDPTIFKVMCVSVGLTWLAWIMSLIGVSKKSSYQPLNQ