Scaffold Ga0186038_115300

Overview

Basic Information

• Taxon OID: 3300017357
• Scaffold ID: Ga0186038_115300
• Source Dataset Name: Metatranscriptome of marine host-associated eukaryotic communities from unknown location in f/2 medium with natural seawater, 50% L1 mix, no silicate, at 29 C, 35 psu salinity and 369 ?mol photons light - Symbiodinium sp. C1 (MMETSP1369)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1187
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050388	Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186038_1153002	F050388	GGAG	MIKYFGLDVYMYGDMGRSCNILQRIAEMNEVDQAKLQENDLVRITLSSTGGVPSSSHQEVLGASGFSERSLENSYGAYPNSITIKFLKHRVKVEAMELRAKIADVLAHMSNKWTFKHGQESVNMSYSFSRSEPGTGRLDTPGLGQAFVDEVVWLFPRDFCLEHIVLWGHVIEKT