Scaffold Ga0186039_125842

Overview

Basic Information

• Taxon OID: 3300017342
• Scaffold ID: Ga0186039_125842
• Source Dataset Name: Metatranscriptome of marine host-associated eukaryotic communities from unknown location in f/2 medium with natural seawater, 50% L1 mix, no silicate, at 26 C, 35 psu salinity and 387 ?mol photons light - Symbiodinium sp. cladeA (MMETSP1374)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 673
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063312	Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186039_1258421	F063312	N/A	MPDFKCAVNENNKSTELPLLRLGGSVQQNPHMRAFWGSTISFFLAFLGWFALAPLGLEVAKSMEICENQLYPPQEYKTRKAYLKFKNLKTEKLYCRYGKNNKDNPTACKPMPDDIAAAISGAADNEEAQAAACVAAGYEADCWNIYNPDVLTKCVCTKGTECAATLTDGGVASVASTIGMRVLLGTLLERFGPVNVQSGLLLFGAIWVA