Scaffold Ga0186048_1020534

Overview

Basic Information

• Taxon OID: 3300017339
• Scaffold ID: Ga0186048_1020534
• Source Dataset Name: Metatranscriptome of marine host-associated eukaryotic communities from Atlantic Ocean in L1 medium w/o silica, 26 C, 35 psu salinity and 402 ?mol photons light - Symbiodinium sp. D1a (MMETSP1377)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 745
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 24.7335
  • Long. (^o): -80.769167

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003025	Metagenome / Metatranscriptome	512	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186048_10205341	F003025	N/A	GKCNKEFWSKWVPRRIKHNFFVLALWTCVWMLGTYPLGRPLSEGWRFMFTVSFFARVGYSAAWMFITNFTHSLPWNEFLAQDPGRTWPVLHNVMAMVLGGKHRWNEMLFHDVHHAFPNAVGTLSQRGRFHGWEKVHDAAAEVLHRGLWKPNGDEETQMQKTQKKRSLMMKQGK