| Basic Information | |
|---|---|
| Taxon OID | 3300017339 Open in IMG/M |
| Scaffold ID | Ga0186048_1016093 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine host-associated eukaryotic communities from Atlantic Ocean in L1 medium w/o silica, 26 C, 35 psu salinity and 402 ?mol photons light - Symbiodinium sp. D1a (MMETSP1377) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 851 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 24.7335 | Long. (o) | -80.769167 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028813 | Metatranscriptome | 190 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186048_10160932 | F028813 | GAGG | MKLKFSPDLVIQSEQFLKRWCPKRPEKAHTIPRVLPTVNEFLSIKKLPVDERWQMLALAGAGSFDPKLDSDPSNPVYTQWVHESMTQNKLACVTAGKEFTWGANVPASTVVVTKSFAETTSVAGMLQYVGRAARRGLTTHGQAIFERDEDLQRIFASPDGLSTEALTMERYAEWWLSRGKVW |
| ⦗Top⦘ |