NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186050_1025449

Scaffold Ga0186050_1025449


Overview

Basic Information
Taxon OID3300017335 Open in IMG/M
Scaffold IDGa0186050_1025449 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from York River, Chesapeake Bay in f/2 medium with natural seawater and antibiotics, no silicate, 22 C, 21 psu salinity and 269 ?mol photons light - Kryptoperidinium foliaceum CCAP 1116/3 (MMETSP0119_2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)858
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameUSA: York River, Chesapeake Bay
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034578Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0186050_10254491F034578N/ALRSLQADGKGPLFSAMLCHLLYALAVMVPLHPKAAANSATVRGAAFAQLMKVQSMVARGVEPRSLFDPLDGSRAKLFLYIKATASIRAALTCITGSWLAADFGARFAVTEEGGRDFIQYCTRHIQQIYNNKTALTRVLGTPWERVMLSQGPTSTIAELLMMICSTESNLKEVARLGGEQALHALSRYGESAQVKQQATMLLTKLAVMQQIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.