Scaffold Ga0186437_1028880

Overview

Basic Information

• Taxon OID: 3300017333
• Scaffold ID: Ga0186437_1028880
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with artificial seawater w/o silicate, 18 C, 28 psu salinity and 260 ?mol photons light - Lingulodinium polyedrum CCMP 1738 (MMETSP1034)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 928
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 27.8
  • Long. (^o): -97.13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013498	Metatranscriptome	270	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186437_10288801	F013498	N/A	MAALVTRGNSADTACAAEDLAARVVMQNRLADLCVDMCKEVGAYPEKCTCPNYVDTTDKTPGVLTWDELLKYMGDLKSWGRDSLKTWKKKIMSTIQQRQVLHATHASAACLAQDTRHRAAVQNKLVDACIDMCKELGAYPEKCTCPNYVDTTDKTPGVITWEELLAYMEKVGTRGDEALKSWDSKAPR