NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186631_1042668

Scaffold Ga0186631_1042668


Overview

Basic Information
Taxon OID3300017320 Open in IMG/M
Scaffold IDGa0186631_1042668 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater ice eukaryotic communities from Messo in f/2 medium with sea water w/o silica, 3 C, 30 psu salinity and 346 ?mol photons light - Scrippsiella hangoei SHHI-4 (MMETSP0369)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)617
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameRussia: Messo
CoordinatesLat. (o)68.46306Long. (o)78.22333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037557Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0186631_10426681F037557N/AHTTLEQPRPSAWAHPSVRTLLVIMASAVPLLLGPGKAKGKHTKFSIFYGADEYLDQLSKKYEEYDELASLLMASPDGGHDADQAKSAVNKANAQGAQPGGKMLTLDVDENKRSKMTKRAIPTPNIPEPMPPSLAFMFTKISPEQKMYMWNVYTLIFVLECLDVVLYWALLKYGPTFGISYGASTAVFGAIMIALCIQNAYILHDV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.