Scaffold Ga0186226_120028

Overview

Basic Information

• Taxon OID: 3300017312
• Scaffold ID: Ga0186226_120028
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Southern Kattegat in F/2 medium with seawater, 15 C, 33 psu salinity and 741 ?mol photons light - Heterocapsa rotundata SCCAP K-0483 (MMETSP0503)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 731
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Southern Kattegat, Buoy St.
• Coordinates
  • Lat. (^o): 56.0
  • Long. (^o): 11.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001618	Metagenome / Metatranscriptome	662	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186226_1200281	F001618	N/A	AISARAFVAKTPGPPPQLPFPTMWRPDAGPCVAQVEEWGEHADDVEYIRQLKAMPKRILKRREIVVKSKDLERACKKQGKVNFSIATWPLSEYSKSSGLGDEAASLVHVFYESRDERKVLNAFSSANIELETAEAVPVDPSSTLAHEQEIMYSKQSLYIQDEYIYEEGPPMSTEELKKRFNM