Scaffold Ga0186125_1032752

Overview

Basic Information

• Taxon OID: 3300017307
• Scaffold ID: Ga0186125_1032752
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from unknown location in GSe medium wiht seawater and antibiotics, at 22 C, 18 psu salinity and 261 ?mol photons light - Durinskia baltica CSIRO CS-38 (MMETSP0117_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Thoracosphaerales → Thoracosphaeraceae → Thoracosphaera → Thoracosphaera heimii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078185	Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186125_10327521	F078185	N/A	VRACIRPPPTLPSRHAPRASSAPSAMGNPTRLWHSKWFTRYIWGGIAGLQLANWTAEQQYGICRSKNPDVMWPWWHEIMRKKELGEIPKDMPGYMLSKYRNEPEERWTAERESEFGEFMGAMNVE