| Basic Information | |
|---|---|
| Taxon OID | 3300017303 Open in IMG/M |
| Scaffold ID | Ga0186630_1043434 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of freshwater ice eukaryotic communities from Messo in MWC medium with 4.55 nmol/L selenium, 3 C, 0 psu salinity and 680 ?mol photons light - Scrippsiella hangoei SHHI-4 (MMETSP0367) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 583 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Russia: Messo | |||||||
| Coordinates | Lat. (o) | 68.46306 | Long. (o) | 78.22333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025290 | Metagenome / Metatranscriptome | 202 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186630_10434342 | F025290 | AGG | MVKTCLKPATKAGKRVIFGKVVMVKAKPAKTIVKAYLVMALKKAV |
| ⦗Top⦘ |