Basic Information | |
---|---|
Taxon OID | 3300017303 Open in IMG/M |
Scaffold ID | Ga0186630_1035566 Open in IMG/M |
Source Dataset Name | Metatranscriptome of freshwater ice eukaryotic communities from Messo in MWC medium with 4.55 nmol/L selenium, 3 C, 0 psu salinity and 680 ?mol photons light - Scrippsiella hangoei SHHI-4 (MMETSP0367) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 766 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Russia: Messo | |||||||
Coordinates | Lat. (o) | 68.46306 | Long. (o) | 78.22333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001939 | Metatranscriptome | 614 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186630_10355661 | F001939 | GGA | MKAVVAIVLFLAATECSGVKVLRRRDTPEEQRLDMEYRAEDSFGKTALTPACAKVECGEYSCPTPFELKKDATCCGYCWAPDHVVAADRHVVTAFNATGNVIEQCEEAPSTCKGPGANVVRCFRPSCRNGDVPNCSPGSCCPMCTTR |
⦗Top⦘ |