Scaffold Ga0186450_113379

Overview

Basic Information

• Taxon OID: 3300017300
• Scaffold ID: Ga0186450_113379
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Girton, Cambridgeshire in DY-V medium with yeast, 18 C, 0 psu salinity and 471 ?mol photons light - Spumella elongata CCAP 955/1 (MMETSP1098)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 821
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: United Kingdom: Girton, Cambridgeshire
• Coordinates
  • Lat. (^o): 52.2333
  • Long. (^o): 0.08333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097377	Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186450_1133792	F097377	AGG	MRAIDYAASQGYRFPNEHPITEFLKSKGSQHTWWGAVCAGDFPRVKEFVENGQDLDEINPVLWNGNGIFIAQEYGQPRIAHYLLTKGATVAVRNAHTVDTHEMKWSVGRGDAFFYKACKVERPGAGVEDHYWPEHQ