Basic Information | |
---|---|
Taxon OID | 3300017293 Open in IMG/M |
Scaffold ID | Ga0186689_1042087 Open in IMG/M |
Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from Indian River Bay, Delaware, USA in L1 medium, 22 C, 34 psu salinity and 335 ?mol photons light - Prorocentrum minimum CCMP 2233 (MMETSP0269) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 557 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Indian River Bay, Delaware | |||||||
Coordinates | Lat. (o) | 38.59 | Long. (o) | -75.1 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038978 | Metatranscriptome | 164 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186689_10420871 | F038978 | N/A | KREETGTWVNTGLHYQAWKAIKAAGAYKDASWVVKVDCDAVFVPSRLVSWLSDKLVPNTGTYLENCRFVKYGWFGSLEIFSKVAFETLLASMGSCKETVDWKVGIEGGKYGPMGEDLFAQACLDKSGVRRGEAFGTKLDGTCEADRPFDQKKNKKWKPTCDQENFAAYHPLMKPQDWWACWDATT |
⦗Top⦘ |