NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186689_1041497

Scaffold Ga0186689_1041497


Overview

Basic Information
Taxon OID3300017293 Open in IMG/M
Scaffold IDGa0186689_1041497 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal eukaryotic communities from Indian River Bay, Delaware, USA in L1 medium, 22 C, 34 psu salinity and 335 ?mol photons light - Prorocentrum minimum CCMP 2233 (MMETSP0269)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)566
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameUSA: Indian River Bay, Delaware
CoordinatesLat. (o)38.59Long. (o)-75.1Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067378Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0186689_10414971F067378N/AEGGAQTPEELGFSDSGDSDDAGSYGKSQFGEEFCLDIGAKGFPIPTFKMLQAANWDAATYFAQLQGAGYAEDALQMTGPDAALLKSDCMRERSHGRTKHIFVGDSQMMSLRNAFHRLNKCPEIWWSNHTEQDISDMMGTVRRNDKSKSRTGSNARFYSKAEQAPAQLPHGCTEEGIGSFIHWDGWVSH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.