Scaffold Ga0186675_122524

Overview

Basic Information

• Taxon OID: 3300017283
• Scaffold ID: Ga0186675_122524
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from North Sea in IMR 1/2 medium with 10nM Se, no NCl and Si, 16 C, 25 psu salinity and 308 ?mol photons light - Chrysochromulina rotalis UIO044 (MMETSP0287)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 662
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Prymnesium → Prymnesium polylepis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Sea
• Coordinates
  • Lat. (^o): 58.11
  • Long. (^o): 9.06
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017834	Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186675_1225241	F017834	N/A	MGKGRGIQTFXXXXXNLTKKEGRTIRKTECMIQYHLARMPMYGAHESPQFMKANEMKENIKNIEAKAKQRWELGHV