Basic Information | |
---|---|
Taxon OID | 3300017274 Open in IMG/M |
Scaffold ID | Ga0186087_1028316 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from unknown location in L1 medium, low N, at 18 C, 32 psu salinity and 229 ?mol photons light - Prorocentrum minimum CCMP 1329 (MMETSP0055) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 700 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015174 | Metatranscriptome | 256 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186087_10283161 | F015174 | N/A | GAPTPPPMASPAGSGGPPSIGGMGTVTATGDPHLQNIYGERFDVVRPGRHVLVQIPRGEPAENTLLRVVAEARRIGGHCSDMYFQGLNVTGAWAEMKHRGGYHFKSQSLVHDTPEWVGLGKIEVKIVHGRTQQGTHYLNFYVRHLGRAGFAVGGLLGEDDHHDAVTPPESCVQRLSLLAQSVDTDSHGSALSVAEASFD |
⦗Top⦘ |