| Basic Information | |
|---|---|
| Taxon OID | 3300017272 Open in IMG/M |
| Scaffold ID | Ga0186043_1008466 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine host-associated eukaryotic communities from Pacific Ocean in f/2 medium w/o silicate, 25 C, 35 psu salinity and 713 ?mol photons light - Gambierdiscus australes CAWD 149 (MMETSP0766_2) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1487 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Peridiniales → Endodiniaceae → Brandtodinium → Brandtodinium nutricula | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 35.0 | Long. (o) | 173.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026570 | Metatranscriptome | 197 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186043_10084662 | F026570 | GAG | VNSITDEVLPSYLRSGFHCAIGDSSPGFGRGEHCGECYKLTSLQDDGVAGTPGSAGSAVVMVSNGGAGGSAHFDCIMEGFEEITGARTGIFDIEFQQVPCVDVVGGPVVINWADQNAYYCKMLFGNVGGWGQLESVLACLDGKGCKEMQRFAGATWTGCPTGTGNKMTFELRQRSPSGEESAVSCECLGSWPWPNGQRCSCPTNFEA |
| ⦗Top⦘ |