Scaffold Ga0186431_107310

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186431_107310

Scaffold Ga0186431_107310

Overview

Basic Information
Taxon OID	3300017265 Open in IMG/M
Scaffold ID	Ga0186431_107310 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic communities from Gulf of Mexico in f/2 medium with silicate, 20 C, 21 psu salinity and 315 ?mol photons light - Stephanopyxis turris CCMP 815 (MMETSP0794_2)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	National Center for Genome Resources
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1311
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	29.4666	Long. (^o)	-86.121	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098601	Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186431_1073101	F098601	AGGA	MGGNKNKKHVEHEITLNKKDLKKVTKLEAQIPYYEGRNQKEEVEKIKQQIEAIWVKTREAAYA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.