NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186530_109291

Scaffold Ga0186530_109291


Overview

Basic Information
Taxon OID3300017248 Open in IMG/M
Scaffold IDGa0186530_109291 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 311 ?mol photons light - Pseudopedinella elastica CCMP 716 (MMETSP1068)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1503
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)43.0Long. (o)68.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051149Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0186530_1092911F051149N/AMGAGASAPGALEALPDPVTEAAALSLLGDCFDRADWETISGGTGQVKKETFIVTITVRNHAPSLRAWLEFWRIDELEDILLSLDVMTPSDLAILEVKEIEKVGLKAVQRHHFKKAMAHSKYLEAIAFDRPPSPLNLWLETWRLDRLLKSLYDLGVDVKEDIIDMSDNDAKMMNMRLLEECRWKQATGQLIHVIRAFDFADNTRASTPSLTTWLESLKLEELDEPLKELGVCELVDLGDLSMRQLEALQLNRLQRKHWDMGLIQVLKAKKEAALDGKNDDPTFRGWLSSWRLVRLLAVMNELGAYVQQDLLDLEPNQYSLLKMRPLEAIRFEQAMIQIENEFGALDKHL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.