Scaffold Ga0186442_114397

Overview

Basic Information

• Taxon OID: 3300017245
• Scaffold ID: Ga0186442_114397
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Gulf of California (Sea of Cort?s) in ASW medium, resuspended in ASW w/o nitrate, 20 C and 643 ?mol photons light - Extubocellulus spinifer CCMP 396 (MMETSP0698)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1094
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Gulf of California (Sea of Cort?s)
• Coordinates
  • Lat. (^o): 31.3172
  • Long. (^o): -113.56
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059360	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186442_1143971	F059360	N/A	MTLFKEVLVPANLVPAAAVIREGQALSKMTGRKESVDSTVSYLLNPKAQL