NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186613_119875

Scaffold Ga0186613_119875


Overview

Basic Information
Taxon OID3300017212 Open in IMG/M
Scaffold IDGa0186613_119875 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Antarctic Ocean in f/2 medium w/o silicate, 4 C, 31 psu salinity and 521 ?mol photons light - Myrionecta rubra CCMP 2563 (MMETSP0798)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004150Metagenome / Metatranscriptome450Y

Sequences

Protein IDFamilyRBSSequence
Ga0186613_1198752F004150N/AFEVKIAFIIARKRNIVVVLFGTLKVQSFMLTEVRDCDLLIVVTSSTFLKRKDMLKEKSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.