Scaffold Ga0186613_118098

Overview

Basic Information

• Taxon OID: 3300017212
• Scaffold ID: Ga0186613_118098
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in f/2 medium w/o silicate, 4 C, 31 psu salinity and 521 ?mol photons light - Myrionecta rubra CCMP 2563 (MMETSP0798)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 651
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101270	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186613_1180981	F101270	N/A	MRFTKLMMSMLPAVEPWVVPGENVMNPGGVENVNPLDTLSSEYHPWGVRIAPLEYGATDYAQFGEVCGSEGPEGGEWAC