Basic Information | |
---|---|
Taxon OID | 3300017212 Open in IMG/M |
Scaffold ID | Ga0186613_106139 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in f/2 medium w/o silicate, 4 C, 31 psu salinity and 521 ?mol photons light - Myrionecta rubra CCMP 2563 (MMETSP0798) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1378 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086658 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186613_1061391 | F086658 | GGCGG | MPSGNGQDGMMSALWEMGCEEDSDYHQVVGDGASGQGCGPLCQIRLVESQVRVIERAEKRSTPQG |
⦗Top⦘ |