Scaffold Ga0186370_108954

Overview

Basic Information

• Taxon OID: 3300017197
• Scaffold ID: Ga0186370_108954
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in K medium with artificial sea water, no silicate, 21 C, 35 psu salinity and 761 ?mol photons light - Isochrysis sp. CCMP1244 (MMETSP1090)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 947
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean
• Coordinates
  • Lat. (^o): 38.3048
  • Long. (^o): -69.6192
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098706	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186370_1089541	F098706	N/A	PLQIAHPSSSSTTMLATSMLSLSANRAEVSTGNLRGDAGKFDNLKASWEKGLEIGDFKTKVAAKYDYNSNKDFLKEVSFSGDLVEGDSADDVSVSYELRRDFASKRSDVRLTASSQGTTLSAEYDTEDQLTEVAVQREVDLGDQKVDVQPSWMVKAKAARVKLMSGLNNGKDKVSAQFDYDVDGKEVGALEVGFTRQLKAGQTLAASYKPDKSDLEVSLQDDNFEDGATWTATANVPLESADANLLDAARVTLKRSWGW