Scaffold Ga0186446_113626

Overview

Basic Information

• Taxon OID: 3300017113
• Scaffold ID: Ga0186446_113626
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Great South Bay, New York in GSe medium with ammonium, 22 C, 32 psu salinity and 177 ?mol photons light - Aureococcus anophagefferens CCMP 1850 (MMETSP0915)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 567
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: USA: Great South Bay, Long Island, New York
• Coordinates
  • Lat. (^o): 40.6508
  • Long. (^o): -73.1524
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066421	Metatranscriptome	126	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186446_1136261	F066421	N/A	SGPNCGPGKAHQYYNTQSDWDSSCSTRVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC