Scaffold Ga0186594_113326

Overview

Basic Information

• Taxon OID: 3300017070
• Scaffold ID: Ga0186594_113326
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 478 ?mol photons light - Phaeocystis sp. CCMP2710 (MMETSP1162)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 581
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Arabian Sea
• Coordinates
  • Lat. (^o): 23.5643
  • Long. (^o): 58.853

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010127	Metagenome / Metatranscriptome	308	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186594_1133261	F010127	N/A	MALAALSGDEQLVIFVQLCNVLDPGVAVAFASASKELWELTQAPRQELQAAAALGRKAGKRSCKELREAKRVDWDGKGLTPADLGLLGKLGSLLPALEHLTLIELSGAAGPDGVQRLAEKLGAGALPAVTWLNLFNTPVGDA