NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186594_112836

Scaffold Ga0186594_112836


Overview

Basic Information
Taxon OID3300017070 Open in IMG/M
Scaffold IDGa0186594_112836 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 478 ?mol photons light - Phaeocystis sp. CCMP2710 (MMETSP1162)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterNational Center for Genome Resources
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)601
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location
Location NameArabian Sea
CoordinatesLat. (o)23.5643Long. (o)58.853Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091179Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0186594_1128362F091179N/AQNFFSHEMLSVVASSALALNIGTSALTSARAAPSMAAALETKFVYERPAPIGTTTGPEYPNTALYAPKLEGVVGKVVPTNMNGKSPKFLQQDFLFGKPERPGVYYQQCTPPSMGENRRSWQAYHAPY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.