Scaffold Ga0186252_110672

Overview

Basic Information

• Taxon OID: 3300017062
• Scaffold ID: Ga0186252_110672
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Ross Sea in L1 medium with seawater, 2 C, 33 psu salinity and 569 ?mol photons light - Phaeocystis antarctica CCMP 1374 (MMETSP1444)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 708
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Ross Sea
• Coordinates
  • Lat. (^o): -77.8333
  • Long. (^o): 163.0
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098438	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186252_1106721	F098438	N/A	FLIDRTFEAFLQKVVDAVVSVYDKYLEPEDLVGYYGLGDGWIFRAQPKGANDAKLREQIVSSVEKAGDPHVYSSIETCIGCLARQVDAKYSKWLVVLTDTVDFECVNERNQFDKESPVRAEAAVRRVTAKMREMAGLNLVLIDASCIANFDAKHSMWPTWQRLSQKLTDEVGEHNSGLSIQAADTDEIDEAFERVAGAMAXXXXXXXXXXXXPPSETEHDQCMSTCGL