Scaffold Ga0186503_105033

Overview

Basic Information

• Taxon OID: 3300017035
• Scaffold ID: Ga0186503_105033
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in seawater with wheat grains, 20 C, 35 psu salinity and 122 ?mol photons light - Paramoeba atlantica 621/1 / CCAP 1560/9 (MMETSP0151_2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1437
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Discoba → Euglenozoa → Euglenida → Spirocuta → Euglenophyceae → Eutreptiales → Eutreptiella → Eutreptiella gymnastica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 29.60806
  • Long. (^o): -28.98667
  • Depth (m): 267.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004926	Metagenome / Metatranscriptome	418	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186503_1050331	F004926	N/A	QIELFQKAKRTLHCVRIKNPGQGKDWTVKNVWSHAKTMVDVFESKGLQPPIIYIHNHDFNGMGAHIGAEVFRLAHAEGFSNLIIDAGYRKNXXXXVLLSVLNLTDEQREALVEWNHNQQEIERILCRFNSRDSQMTPWDSDWAGGTEGSDIRIAKEYALDVRKINTAKEIASEVFPLERAVTPFSEYKLRLGXXXYYD