Scaffold Ga0186514_100199

Overview

Basic Information

• Taxon OID: 3300017034
• Scaffold ID: Ga0186514_100199
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in L1 medium with seawater, 20 C, 33 psu salinity and 557 ?mol photons light - Craspedostauros australis CCMP 3328 (MMETSP1442)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3183
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): -38.45
  • Long. (^o): 145.3333
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021307	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186514_1001991	F021307	N/A	MSQIFYEKRCRCKEEFLITKKRKSSNRSEGKPLQYPSSNEILSKTFKIKYENELSSRAKLILNSLKNKYLYYAIDDILFLFKLKPIEGENLLNILYSTVLSIHNNLSIN