| Basic Information | |
|---|---|
| Taxon OID | 3300016991 Open in IMG/M |
| Scaffold ID | Ga0186318_110567 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium with Sargasso seawater w/o nitrate, 14 C, 36 psu salinity and 101 ?mol photons light - Ditylum brightwellii GSO105 (MMETSP1001) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1061 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 47.74 | Long. (o) | -122.417 | Alt. (m) | Depth (m) | .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081743 | Metagenome / Metatranscriptome | 114 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186318_1105672 | F081743 | GGA | MHSLDHALMDWNLEDPLWLDVDDPKYGKMAEIGRIIKVGFVPEVGGYYFHRKWKGSGHPFYEAVYRKLVKIDRKFADAMDTCICR |
| ⦗Top⦘ |