Scaffold Ga0186367_111177

Overview

Basic Information

• Taxon OID: 3300016990
• Scaffold ID: Ga0186367_111177
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 23 C, 34 psu salinity and 120 ?mol photons light - Cyclophora tenuis ECT3854 (MMETSP0397)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 619
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Fragilariophyceae → Fragilariophycidae → Cyclophorales → Cyclophoraceae → Cyclophora → Cyclophora tenuis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates
  • Lat. (^o): 21.514
  • Long. (^o): -157.8362
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067805	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186367_1111771	F067805	N/A	MGGKKNKQSMEEVSLSKKDAKKVAKLEAQIPYHTGRGNMEEVEKIKGQIDAIWQKTREAAFAM