Basic Information | |
---|---|
Taxon OID | 3300016990 Open in IMG/M |
Scaffold ID | Ga0186367_111177 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in enriched f/2 medium with seawater, 23 C, 34 psu salinity and 120 ?mol photons light - Cyclophora tenuis ECT3854 (MMETSP0397) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 619 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Fragilariophyceae → Fragilariophycidae → Cyclophorales → Cyclophoraceae → Cyclophora → Cyclophora tenuis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 21.514 | Long. (o) | -157.8362 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067805 | Metagenome / Metatranscriptome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186367_1111771 | F067805 | N/A | MGGKKNKQSMEEVSLSKKDAKKVAKLEAQIPYHTGRGNMEEVEKIKGQIDAIWQKTREAAFAM |
⦗Top⦘ |