| Basic Information | |
|---|---|
| Taxon OID | 3300016923 Open in IMG/M |
| Scaffold ID | Ga0186368_107423 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in L1 medium, 16 C, 25 psu salinity and 192 ?mol photons light - Alexandrium minutum CCMP 113 (MMETSP0328) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 521 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 42.23 | Long. (o) | -8.8 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026799 | Metagenome / Metatranscriptome | 196 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186368_1074231 | F026799 | N/A | RSHFGSRVAEPRVAPAWATLVAMGAQGSCCSCEDETXXXXXXPRRESRKRSPNEFTIIIDRRSGEGLGIDASPEKNGTLEIKNITPGGLVDRWNQSLPDDSREHVRPGMRVIEVNGRYNSAMQLIAACRETEVLHMTMALPEH |
| ⦗Top⦘ |