Scaffold Ga0186368_106989

Overview

Basic Information

• Taxon OID: 3300016923
• Scaffold ID: Ga0186368_106989
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Atlantic Ocean in L1 medium, 16 C, 25 psu salinity and 192 ?mol photons light - Alexandrium minutum CCMP 113 (MMETSP0328)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 555
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean
• Coordinates
  • Lat. (^o): 42.23
  • Long. (^o): -8.8
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060925	Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186368_1069891	F060925	N/A	SVAILAQDGTCRLKLCPLEPFSVMLRVKEVEATLGRAMTDGVTNVMLVNDEGALIAAARSEEVDHTVSAVLASIYSEYKVAERFVDPGSPSSLQSILFDCATARVACTSFVQCAEDSQILLCVCGDRRTHYGILWSKLELLRSSLECLGPIFTPMAGVGA