Scaffold Ga0186073_100018

Overview

Basic Information

• Taxon OID: 3300016916
• Scaffold ID: Ga0186073_100018
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium w/o silicate, at 20 C, 30 psu salinity and 483 ?mol photons light - Chaetoceros neogracile CCMP 1317 (MMETSP0752)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8897
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017555	Metagenome / Metatranscriptome	240	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186073_1000186	F017555	AGGAG	LFLHELLKRILKQIEKQNDKENCSMVQKIVDPNFNIKTFNVKCDNELSSLAKTIIKSFKFKLYYYVMDDLVYLLKSNPTERDYLLQILHSSVIFLQNNLYVNFFDIYIYDISLNEKSKFNRFITEQSTSFKVSNTITIKLAYQVKPVTKKLETTW