Scaffold Ga0186579_113841

Overview

Basic Information

• Taxon OID: 3300016906
• Scaffold ID: Ga0186579_113841
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ESM medium with SW802, 23 C, 35 psu salinity and 431 ?mol photons light - Goniomonas sp. m (MMETSP0114)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 522
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 46.5105
  • Long. (^o): -63.4856
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086665	Metagenome / Metatranscriptome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186579_1138411	F086665	N/A	RAYVAAGNNMVFMGGYLSLQVMNDIFGFSLRDDFKEGPYYRNDRNVRDTPFQFLPSRINEPSPRVFGAMSRSLPPGGRSLYDSLGCSVVFYISYDLGTIVYVGFQYDTPFTIDRWVRVLHAAIDM