Scaffold Ga0186363_102946

Overview

Basic Information

• Taxon OID: 3300016867
• Scaffold ID: Ga0186363_102946
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in f/2 medium with artificial seawater, no silicate, 21 C, 35 psu salinity and 410 ?mol photons light - micromonas sp. NEPCC29 (MMETSP1082)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2401
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates
  • Lat. (^o): 49.25
  • Long. (^o): -123.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062730	Metagenome / Metatranscriptome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186363_1029461	F062730	N/A	MGNETPVGYRLVRVGVRGRVPILHTQASDDLTTRQKYDLRYREKHRAKLLAYHREYY