Scaffold Ga0186380_11286

Overview

Basic Information

• Taxon OID: 3300016825
• Scaffold ID: Ga0186380_11286
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in L1 medium with natural Eastern Pacific seawater, no silica (Eastern Pacific), 23 C, 36 psu salinity and 621 ?mol photons light - Bathycoccus prasinos CCMP 1898 (MMETSP1399)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3147
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Bathycoccaceae → Bathycoccus → Bathycoccus prasinos (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066125	Metagenome / Metatranscriptome	127	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0186380_112862	F066125	N/A	VLEEAAKSKEKSQQVPEITFLTANAHVCAGRTKYPCDSERVKLFRKASRNGFHSAALTAAEILITRYGGEYADKEGACGSKSATTGEMTFPEANDPADAVVAKSLLKPLLATSLDKKAKTRLKELEKIEETLIGGGKLEPDVAMQMADVVVDIGLKILIGVCVVCVVFKFRETRLVSAAFAFLCKITGASAVRRFYRFLRGDFDASARVNAGRAGSRAEMRAEAKRMAKELYKNGKKKET