NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182082_1381402

Scaffold Ga0182082_1381402


Overview

Basic Information
Taxon OID3300016771 Open in IMG/M
Scaffold IDGa0182082_1381402 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)860
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071780Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0182082_13814021F071780N/ARMTLQLTDYERGYLTAYYDTVVFDAMADSCDEDWFGVKIGDRMFDLNAWADEDTGKFVCVVYDCIWVNDNWQTNSAQNGWILTEENDT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.