| Basic Information | |
|---|---|
| Taxon OID | 3300016746 Open in IMG/M |
| Scaffold ID | Ga0182055_1120829 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 591 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 31.972 | Long. (o) | -81.028 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030555 | Metagenome / Metatranscriptome | 185 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182055_11208291 | F030555 | N/A | WCLLNEQFAWWYVLVAVILLVPLFIGVCFYISYYAEDTDSSRSKLFVSCQFVIYSSCLLGIWNTCYLLWCYKYDDVSIGSPDQGYYKQTKKSFIVWSLFLATAISFLWAYFLCVCRTYSNALKSEEQLEKERLEQLEKDKNGPFGFKIPEVKVPGVGKMEGMEGGDMMMDPPMEEAM |
| ⦗Top⦘ |